Recombinant Human Vasopressin V1b receptor (AVPR1B)

Produktübersicht

• Artikelname: Recombinant Human Vasopressin V1b receptor (AVPR1B)
• Artikelnummer: CSB-CF002469HU(A4)
• Hersteller Artikelnummer: CSB-CF002469HU(A4)
• Alternativnummer: CSB-CF002469HU(A4)-100, CSB-CF002469HU(A4)-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: (V1bR)(AVPR V1b)(AVPR V3)(Antidiuretic hormone receptor 1b)(Vasopressin V3 receptor),CSB-PR2024

Produkteigenschaften

• Molekulargewicht: 53.0 kDa
• Tag: N-terminal 10xHis-tagged
• UniProt: P47901
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: in vitro E.coli expression system
• Expression System: 1-424aa
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MDSGPLWDANPTPRGTLSAPNATTPWLGRDEELAKVEIGVLATVLVLATGGNLAVLLTLGQLGRKRSRMHLFVLHLALTDLAVALFQVLPQLLWDITYRFQGPDLLCRAVKYLQVLSMFASTYMLLAMTLDRYLAVCHPLRSLQQPGQSTYLLIAAPWLLAAIFSLPQVFIFSLREVIQGSGVLDCWADFGFPWGPRAYLTWTTLAIFVLPVTMLTACYSLICHEICKNLKVKTQAWRVGGGGWRTWDRPSPST