Recombinant Mouse BCL2/adenovirus E1B 19 kDa protein-interacting protein 3 (Bnip3), partial

Produktübersicht

• Artikelname: Recombinant Mouse BCL2/adenovirus E1B 19 kDa protein-interacting protein 3 (Bnip3), partial
• Artikelnummer: CSB-CF002766MO2
• Hersteller Artikelnummer: CSB-CF002766MO2
• Alternativnummer: CSB-CF002766MO2-100, CSB-CF002766MO2-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: Nip3,CSB-PR2024

Produkteigenschaften

• Molekulargewicht: 21.3 kDa
• Tag: N-terminal 6xHis-tagged
• UniProt: O55003
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: in vitro E.coli expression system
• Expression System: 50-187aa
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: RSSSKSSHCDSPPRSQTPQDTNRAEIDSHSFGEKNSTLSEEDYIERRREVESILKKNSDWIWDWSSRPENIPPKEFLFKHPKRTATLSMRNTSVMKKGGIFSADFLKVFLPSLLLSHLLAIGLGIYIGRRLTTSTSTF