Recombinant Human C-C chemokine receptor type 4(CCR4) (Active)

Produktübersicht

• Artikelname: Recombinant Human C-C chemokine receptor type 4(CCR4) (Active)
• Artikelnummer: CSB-CF004843HU
• Hersteller Artikelnummer: CSB-CF004843HU
• Alternativnummer: CSB-CF004843HU-100, CSB-CF004843HU-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: K5-5 CD_antigen: CD194

Produkteigenschaften

• Molekulargewicht: 44.9 kDa
• Tag: N-terminal 10xHis-tagged
• UniProt: P51679
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: in vitro E.coli expression system
• Expression System: 1-360aa
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MNPTDIADTTLDESIYSNYYLYESIPKPCTKEGIKAFGELFLPPLYSLVFVFGLLGNSVVVLVLFKYKRLRSMTDVYLLNLAISDLLFVFSLPFWGYYAADQWVFGLGLCKMISWMYLVGFYSGIFFVMLMSIDRYLAIVHAVFSLRARTLTYGVITSLATWSVAVFASLPGFLFSTCYTERNHTYCKTKYSLNSTTWKVLSSLEINILGLVIPLGIMLFCYSMIIRTLQHCKNEKKNKAVKMIFAVVVLFLGF