Recombinant Human C-C chemokine receptor type 6 (CCR6)

Produktübersicht

• Artikelname: Recombinant Human C-C chemokine receptor type 6 (CCR6)
• Artikelnummer: CSB-CF004845HUA2
• Hersteller Artikelnummer: CSB-CF004845HUa2
• Alternativnummer: CSB-CF004845HUA2-100, CSB-CF004845HUA2-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: Chemokine receptor-like 3

Produkteigenschaften

• Molekulargewicht: 58.5 kDa
• Tag: N-terminal 6xHis-SUMO-tagged
• UniProt: P51684
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: in vitro E.coli expression system
• Expression System: 1-374aa
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MSGESMNFSDVFDSSEDYFVSVNTSYYSVDSEMLLCSLQEVRQFSRLFVPIAYSLICVFGLLGNILVVITFAFYKKARSMTDVYLLNMAIADILFVLTLPFWAVSHATGAWVFSNATCKLLKGIYAINFNCGMLLLTCISMDRYIAIVQATKSFRLRSRTLPRSKIICLVVWGLSVIISSSTFVFNQKYNTQGSDVCEPKYQTVSEPIRWKLLMLGLELLFGFFIPLMFMIFCYTFIVKTLVQAQNSKRHKAIR