Recombinant Human C-C chemokine receptor type 8 (CCR8)

Produktübersicht

• Artikelname: Recombinant Human C-C chemokine receptor type 8 (CCR8)
• Artikelnummer: CSB-CF004847HU
• Hersteller Artikelnummer: CSB-CF004847HU
• Alternativnummer: CSB-CF004847HU-100, CSB-CF004847HU-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: CC chemokine receptor CHEMR1 CMKBRL2 Chemokine receptor-like 1 Short name: CKR-L1 GPR-CY6 Short name: GPRCY6 TER1 CD_antigen: CDw198

Produkteigenschaften

• Molekulargewicht: 41.7 kDa
• Tag: C-terminal 6xHis-tagged
• UniProt: P51685
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: in vitro E.coli expression system
• Expression System: 1-355aa
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MDYTLDLSVTTVTDYYYPDIFSSPCDAELIQTNGKLLLAVFYCLLFVFSLLGNSLVILVLVVCKKLRSITDVYLLNLALSDLLFVFSFPFQTYYLLDQWVFGTVMCKVVSGFYYIGFYSSMFFITLMSVDRYLAVVHAVYALKVRTIRMGTTLCLAVWLTAIMATIPLLVFYQVASEDGVLQCYSFYNQQTLKWKIFTNFKMNILGLLIPFTIFMFCYIKILHQLKRCQNHNKTKAIRLVLIVVIASLLFWVPF