Recombinant Human C-C chemokine receptor type 8 (CCR8), partial,Nanodiscs

Produktübersicht

• Artikelname: Recombinant Human C-C chemokine receptor type 8 (CCR8), partial,Nanodiscs
• Artikelnummer: CSB-CF004847HU2-N
• Hersteller Artikelnummer: CSB-CF004847HU2-N
• Alternativnummer: CSB-CF004847HU2-N-100, CSB-CF004847HU2-N-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: CC chemokine receptor CHEMR1,CMKBRL2Chemokine receptor-like 1,CKR-L1,GPR-CY6,GPRCY6,TER1,CDw198

Produkteigenschaften

• Molekulargewicht: 9.4 kDa
• Tag: N-terminal 10xHis-tagged
• UniProt: P51685
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: in vitro E.coli expression system
• Expression System: 74-129aa
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: LLNLALSDLLFVFSFPFQTYYLLDQWVFGTVMCKVVSGFYYIGFYSSMFFITLMSV