Recombinant Human C-C chemokine receptor-like 2 (CCRL2)

Produktübersicht

• Artikelname: Recombinant Human C-C chemokine receptor-like 2 (CCRL2)
• Artikelnummer: CSB-CF004852HU
• Hersteller Artikelnummer: CSB-CF004852HU
• Alternativnummer: CSB-CF004852HU-100, CSB-CF004852HU-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: (Chemokine receptor CCR11)(Chemokine receptor X)(Putative MCP-1 chemokine receptor),CSB-PR2024

Produkteigenschaften

• Molekulargewicht: 45.6 kDa
• Tag: N-terminal 10xHis-tagged
• UniProt: O00421
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: in vitro E.coli expression system
• Expression System: 1-344aa
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MANYTLAPEDEYDVLIEGELESDEAEQCDKYDAQALSAQLVPSLCSAVFVIGVLDNLLVVLILVKYKGLKRVENIYLLNLAVSNLCFLLTLPFWAHAGGDPMCKILIGLYFVGLYSETFFNCLLTVQRYLVFLHKGNFFSARRRVPCGIITSVLAWVTAILATLPEFVVYKPQMEDQKYKCAFSRTPFLPADETFWKHFLTLKMNISVLVLPLFIFTFLYVQMRKTLRFREQRYSLFKLVFAIMVVFLLMWAPY