Recombinant Human CD63 antigen (CD63)

Artikelnummer: CSB-CF004950HU
Artikelname: Recombinant Human CD63 antigen (CD63)
Artikelnummer: CSB-CF004950HU
Hersteller Artikelnummer: CSB-CF004950HU
Alternativnummer: CSB-CF004950HU-100, CSB-CF004950HU-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Alternative Synonym: Granulophysin Lysosomal-associated membrane protein 3 Short name: LAMP-3 Melanoma-associated antigen ME491 OMA81H Ocular melanoma-associated antigen Tetraspanin-30 Short name: Tspan-30 CD_antigen: CD63 MLA1, TSPAN30
Molekulargewicht: 31.5 kDa
Tag: N-terminal 10xHis-tagged
UniProt: P08962
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: in vitro E.coli expression system
Expression System: 2-238aa
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: AVEGGMKCVKFLLYVLLLAFCACAVGLIAVGVGAQLVLSQTIIQGATPGSLLPVVIIAVGVFLFLVAFVGCCGACKENYCLMITFAIFLSLIMLVEVAAAIAGYVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRKNVLVVAAAALGIAFVEVLGIVFACCLVKSIRSGYEVM