Recombinant Human CLIP-associating protein 2 (CLASP2)

Produktübersicht

• Artikelname: Recombinant Human CLIP-associating protein 2 (CLASP2)
• Artikelnummer: CSB-CF005472HU
• Hersteller Artikelnummer: CSB-CF005472HU
• Alternativnummer: CSB-CF005472HU-100, CSB-CF005472HU-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: Cytoplasmic linker-associated protein 2 Protein Orbit homolog 2 Short name: hOrbit2

Produkteigenschaften

• Molekulargewicht: 60.5 kDa
• Tag: N-terminal 6xHis-B2M-tagged
• UniProt: O75122
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: in vitro E.coli expression system
• Expression System: 1-431aa
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MRRLICKRICDYKSFDDEESVDGNRPSSAASAFKVPAPKTSGNPANSARKPGSAGGPKVGGASKEGGAGAVDEDDFIKAFTDVPSIQIYSSRELEETLNKIREILSDDKHDWDQRANALKKIRSLLVAGAAQYDCFFQHLRLLDGALKLSAKDLRSQVVREACITVAHLSTVLGNKFDHGAEAIVPTLFNLVPNSAKVMATSGCAAIRFIIRHTHVPRLIPLITSNCTSKSVPVRRRSFEFLDLLLQEWQTHSL