Recombinant Human Chemerin-like receptor 1 (CMKLR1)

Produktübersicht

• Artikelname: Recombinant Human Chemerin-like receptor 1 (CMKLR1)
• Artikelnummer: CSB-CF005614HUD7
• Hersteller Artikelnummer: CSB-CF005614HUd7
• Alternativnummer: CSB-CF005614HUD7-100, CSB-CF005614HUD7-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: Chemokine-like receptor 1,G-protein coupled receptor ChemR23,G-protein coupled receptor DEZ,CSB-PR2024

Produkteigenschaften

• Molekulargewicht: 43.7 kDa
• Tag: C-terminal 10xHis-tagged
• UniProt: Q99788
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: in vitro E.coli expression system
• Expression System: 1-373aa
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MRMEDEDYNTSISYGDEYPDYLDSIVVLEDLSPLEARVTRIFLVVVYSIVCFLGILGNGLVIIIATFKMKKTVNMVWFLNLAVADFLFNVFLPIHITYAAMDYHWVFGTAMCKISNFLLIHNMFTSVFLLTIISSDRCISVLLPVWSQNHRSVRLAYMACMVIWVLAFFLSSPSLVFRDTANLHGKISCFNNFSLSTPGSSSWPTHSQMDPVGYSRHMVVTVTRFLCGFLVPVLIITACYLTIVCKLQRNRLAK