Recombinant Human Transcriptional repressor CTCF (CTCF), partial

Produktübersicht

• Artikelname: Recombinant Human Transcriptional repressor CTCF (CTCF), partial
• Artikelnummer: CSB-CF006138HU1
• Hersteller Artikelnummer: CSB-CF006138HU1
• Alternativnummer: CSB-CF006138HU1-100, CSB-CF006138HU1-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: 11-zinc finger protein CCCTC-binding factor CTCFL paralog

Produkteigenschaften

• Molekulargewicht: 57.4 kDa
• Tag: N-terminal 6xHis-tagged
• UniProt: P49711
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: in vitro E.coli expression system
• Expression System: 266-727aa
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: FQCELCSYTCPRRSNLDRHMKSHTDERPHKCHLCGRAFRTVTLLRNHLNTHTGTRPHKCPDCDMAFVTSGELVRHRRYKHTHEKPFKCSMCDYASVEVSKLKRHIRSHTGERPFQCSLCSYASRDTYKLKRHMRTHSGEKPYECYICHARFTQSGTMKMHILQKHTENVAKFHCPHCDTVIARKSDLGVHLRKQHSYIEQGKKCRYCDAVFHERYALIQHQKSHKNEKRFKCDQCDYACRQERHMIMHKRTHTG