Recombinant Human C-X-C chemokine receptor type 4 (CXCR4)

Produktübersicht

• Artikelname: Recombinant Human C-X-C chemokine receptor type 4 (CXCR4)
• Artikelnummer: CSB-CF006254HU
• Hersteller Artikelnummer: CSB-CF006254HU
• Alternativnummer: CSB-CF006254HU-100, CSB-CF006254HU-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: FB22 Fusin HM89 LCR1 Leukocyte-derived seven transmembrane domain receptor Short name: LESTR Lipopolysaccharide-associated protein 3 Short name: LAP-3 Short name: LPS-associated protein 3 NPYRL Stromal cell-derived factor 1 receptor Short name: SDF-1 rec

Produkteigenschaften

• Molekulargewicht: 56.2 kDa
• Tag: N-terminal 6xHis-SUMO-tagged
• UniProt: P61073
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: in vitro E.coli expression system
• Expression System: 1-356aa
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MSIPLPLLQIYTSDNYTEEMGSGDYDSMKEPCFREENANFNKIFLPTIYSIIFLTGIVGNGLVILVMGYQKKLRSMTDKYRLHLSVADLLFVITLPFWAVDAVANWYFGNFLCKAVHVIYTVNLYSSVLILAFISLDRYLAIVHATNSQRPRKLLAEKVVYVGVWIPALLLTIPDFIFANVSEADDRYICDRFYPNDLWVVVFQFQHIMVGLILPGIVILSCYCIIISKLSHSKGHQKRKALKTTVILILAFFA