Recombinant Human C-X-C chemokine receptor type 4 (CXCR4)
Artikelnummer:
CSB-CF006254HUA0
- Bilder (0)
| Artikelname: | Recombinant Human C-X-C chemokine receptor type 4 (CXCR4) |
| Artikelnummer: | CSB-CF006254HUA0 |
| Hersteller Artikelnummer: | CSB-CF006254HUa0 |
| Alternativnummer: | CSB-CF006254HUA0-100, CSB-CF006254HUA0-20 |
| Hersteller: | Cusabio |
| Kategorie: | Proteine/Peptide |
| Alternative Synonym: | FB22 Fusin HM89 LCR1 Leukocyte-derived seven transmembrane domain receptor |
| Molekulargewicht: | 44.2 kDa |
| Tag: | N-terminal 6xHis-tagged |
| UniProt: | P61073 |
| Puffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Quelle: | in vitro E.coli expression system |
| Expression System: | 1-356aa |
| Reinheit: | Greater than 90% as determined by SDS-PAGE. |
| Formulierung: | Liquid or Lyophilized powder |
| Sequenz: | MSIPLPLLQIYTSDNYTEEMGSGDYDSMKEPCFREENANFNKIFLPTIYSIIFLTGIVGNGLVILVMGYQKKLRSMTDKYRLHLSVADLLFVITLPFWAVDAVANWYFGNFLCKAVHVIYTVNLYSSVLILAFISLDRYLAIVHATNSQRPRKLLAEKVVYVGVWIPALLLTIPDFIFANVSEADDRYICDRFYPNDLWVVVFQFQHIMVGLILPGIVILSCYCIIISKLSHSKGHQKRKALKTTVILILAFFA |
Produktgarantie und fachkundiger Support
