Recombinant Human Atypical chemokine receptor 3 (ACKR3)

Produktübersicht

• Artikelname: Recombinant Human Atypical chemokine receptor 3 (ACKR3)
• Artikelnummer: CSB-CF006257HU(A4)
• Hersteller Artikelnummer: CSB-CF006257HU(A4)
• Alternativnummer: CSB-CF006257HU(A4)-100, CSB-CF006257HU(A4)-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: C-X-C chemokine receptor type 7 Short name: CXC-R7 Short name: CXCR-7 Chemokine orphan receptor 1 G-protein coupled receptor 159 G-protein coupled receptor RDC1 homolog Short name: RDC-1

Produkteigenschaften

• Molekulargewicht: 57.5 kDa
• Tag: N-terminal 6xHis-SUMO-tagged
• UniProt: P25106
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: in vitro E.coli expression system
• Expression System: 1-362aa
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MDLHLFDYSEPGNFSDISWPCNSSDCIVVDTVMCPNMPNKSVLLYTLSFIYIFIFVIGMIANSVVVWVNIQAKTTGYDTHCYILNLAIADLWVVLTIPVWVVSLVQHNQWPMGELTCKVTHLIFSINLFGSIFFLTCMSVDRYLSITYFTNTPSSRKKMVRRVVCILVWLLAFCVSLPDTYYLKTVTSASNNETYCRSFYPEHSIKEWLIGMELVSVVLGFAVPFSIIAVFYFLLARAISASSDQEKHSSRKII