Recombinant Human Cysteinyl leukotriene receptor 1 (CYSLTR1)

Produktübersicht

• Artikelname: Recombinant Human Cysteinyl leukotriene receptor 1 (CYSLTR1)
• Artikelnummer: CSB-CF006465HU
• Hersteller Artikelnummer: CSB-CF006465HU
• Alternativnummer: CSB-CF006465HU-100, CSB-CF006465HU-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: CysLTR1,Cysteinyl leukotriene D4 receptor,LTD4 receptor,G-protein coupled receptor HG55,HMTMF81

Produkteigenschaften

• Molekulargewicht: 44.6 kDa
• Tag: N-terminal 10xHis-tagged
• UniProt: Q9Y271
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: in vitro E.coli expression system
• Expression System: 1-337aa
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MDETGNLTVSSATCHDTIDDFRNQVYSTLYSMISVVGFFGNGFVLYVLIKTYHKKSAFQVYMINLAVADLLCVCTLPLRVVYYVHKGIWLFGDFLCRLSTYALYVNLYCSIFFMTAMSFFRCIAIVFPVQNINLVTQKKARFVCVGIWIFVILTSSPFLMAKPQKDEKNNTKCFEPPQDNQTKNHVLVLHYVSLFVGFIIPFVIIIVCYTMIILTLLKKSMKKNLSSHKKAIGMIMVVTAAFLVSFMPYHIQRT