Recombinant Human Erlin-1 (ERLIN1)

Produktübersicht

• Artikelname: Recombinant Human Erlin-1 (ERLIN1)
• Artikelnummer: CSB-CF007790HU
• Hersteller Artikelnummer: CSB-CF007790HU
• Alternativnummer: CSB-CF007790HU-100, CSB-CF007790HU-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: Endoplasmic reticulum lipid raft-associated protein 1 Protein KE04 Stomatin-prohibitin-flotillin-HflC/K domain-containing protein 1 Short name: SPFH domain-containing protein 1,CSB-PR2024

Produkteigenschaften

• Molekulargewicht: 42.0 kDa
• Tag: N-terminal 10xHis-tagged
• UniProt: O75477
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: in vitro E.coli expression system
• Expression System: 1-348aa
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MNMTQARVLVAAVVGLVAVLLYASIHKIEEGHLAVYYRGGALLTSPSGPGYHIMLPFITTFRSVQTTLQTDEVKNVPCGTSGGVMIYIDRIEVVNMLAPYAVFDIVRNYTADYDKTLIFNKIHHELNQFCSAHTLQEVYIELFDQIDENLKQALQKDLNLMAPGLTIQAVRVTKPKIPEAIRRNFELMEAEKTKLLIAAQKQKVVEKEAETERKKAVIEAEKIAQVAKIRFQQKVMEKETEKRISEIEDAAFLA