Recombinant Macaca fascicularis Tumor necrosis factor ligand superfamily member 6 (FASLG), partial

Produktübersicht

• Artikelname: Recombinant Macaca fascicularis Tumor necrosis factor ligand superfamily member 6 (FASLG), partial
• Artikelnummer: CSB-CF008434MOV2
• Hersteller Artikelnummer: CSB-CF008434MOV2
• Alternativnummer: CSB-CF008434MOV2-100, CSB-CF008434MOV2-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: CD95 ligand (CD95-L) (Fas antigen ligand) (Fas ligand) (FasL) (CD_antigen: CD178) (CD95L) (FASL) (TNFSF6)

Produkteigenschaften

• Molekulargewicht: 18.5 kDa
• Tag: N-terminal 6xHis-tagged
• UniProt: P63308
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: in vitro E.coli expression system
• Expression System: 102-211aa
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: QLFHLQKELAELRESTSQKHTASSLEKQIGHPSPPPEKKEQRKVAHLTGKPNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQSCTNLPLSHKVY