Recombinant Mouse Formyl peptide receptor 2 (Fpr2)

Produktübersicht

• Artikelname: Recombinant Mouse Formyl peptide receptor 2 (Fpr2)
• Artikelnummer: CSB-CF008855MO
• Hersteller Artikelnummer: CSB-CF008855MO
• Alternativnummer: CSB-CF008855MO-100, CSB-CF008855MO-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: Formylpeptide receptor-related sequence 2,Lipoxin A4 receptor-like protein,N-formylpeptide receptor-like 2,CSB-PR2024

Produkteigenschaften

• Molekulargewicht: 40.9 kDa
• Tag: N-terminal 10xHis-tagged
• UniProt: O88536
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: in vitro E.coli expression system
• Expression System: 1-351aa
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MESNYSIHLNGSEVVVYDSTISRVLWILSMVVVSITFFLGVLGNGLVIWVAGFRMPHTVTTIWYLNLALADFSFTATLPFLLVEMAMKEKWPFGWFLCKLVHIVVDVNLFGSVFLIALIALDRCICVLHPVWAQNHRTVSLARKVVVGPWIFALILTLPIFIFLTTVRIPGGDVYCTFNFGSWAQTDEEKLNTAITFVTTRGIIRFLIGFSMPMSIVAVCYGLIAVKINRRNLVNSSRPLRVLTAVVASFFICW