Recombinant Human Gastric inhibitory polypeptide receptor (GIPR)
Artikelnummer:
CSB-CF009438HU
- Bilder (0)
| Artikelname: | Recombinant Human Gastric inhibitory polypeptide receptor (GIPR) |
| Artikelnummer: | CSB-CF009438HU |
| Hersteller Artikelnummer: | CSB-CF009438HU |
| Alternativnummer: | CSB-CF009438HU-100, CSB-CF009438HU-20 |
| Hersteller: | Cusabio |
| Kategorie: | Proteine/Peptide |
| Alternative Synonym: | (GIP-R)(Glucose-dependent insulinotropic polypeptide receptor) |
| Molekulargewicht: | 52.4 kDa |
| Tag: | N-terminal 10xHis-tagged |
| UniProt: | P48546 |
| Puffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Quelle: | in vitro E.coli expression system |
| Expression System: | 22-466aa |
| Reinheit: | Greater than 85% as determined by SDS-PAGE. |
| Formulierung: | Liquid or Lyophilized powder |
| Sequenz: | RAETGSKGQTAGELYQRWERYRRECQETLAAAEPPSGLACNGSFDMYVCWDYAAPNATARASCPWYLPWHHHVAAGFVLRQCGSDGQWGLWRDHTQCENPEKNEAFLDQRLILERLQVMYTVGYSLSLATLLLALLILSLFRRLHCTRNYIHINLFTSFMLRAAAILSRDRLLPRPGPYLGDQALALWNQALAACRTAQIVTQYCVGANYTWLLVEGVYLHSLLVLVGGSEEGHFRYYLLLGWGAPALFVIPWV |
Produktgarantie und fachkundiger Support
