Recombinant Human Platelet glycoprotein Ib beta chain (GP1BB)
Artikelnummer:
CSB-CF009686HU
- Bilder (0)
| Artikelname: | Recombinant Human Platelet glycoprotein Ib beta chain (GP1BB) |
| Artikelnummer: | CSB-CF009686HU |
| Hersteller Artikelnummer: | CSB-CF009686HU |
| Alternativnummer: | CSB-CF009686HU-100, CSB-CF009686HU-20 |
| Hersteller: | Cusabio |
| Kategorie: | Proteine/Peptide |
| Alternative Synonym: | Antigen CD42b-beta CD_antigen: CD42c,CSB-PR2024 |
| Molekulargewicht: | 39.3 kDa |
| Tag: | N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged |
| UniProt: | P13224 |
| Puffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Quelle: | in vitro E.coli expression system |
| Expression System: | 26-206aa |
| Reinheit: | Greater than 85% as determined by SDS-PAGE. |
| Formulierung: | Liquid or Lyophilized powder |
| Sequenz: | CPAPCSCAGTLVDCGRRGLTWASLPTAFPVDTTELVLTGNNLTALPPGLLDALPALRTAHLGANPWRCDCRLVPLRAWLAGRPERAPYRDLRCVAPPALRGRLLPYLAEDELRAACAPGPLCWGALAAQLALLGLGLLHALLLVLLLCRLRRLRARARARAAARLSLTDPLVAERAGTDES |
Produktgarantie und fachkundiger Support
