Recombinant Human G-protein coupled receptor 15 (GPR15)

Artikelnummer: CSB-CF009764HU
Artikelname: Recombinant Human G-protein coupled receptor 15 (GPR15)
Artikelnummer: CSB-CF009764HU
Hersteller Artikelnummer: CSB-CF009764HU
Alternativnummer: CSB-CF009764HU-100, CSB-CF009764HU-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Alternative Synonym: (Brother of Bonzo)(BoB)
Molekulargewicht: 43.6 kDa
Tag: N-terminal 10xHis-tagged
UniProt: P49685
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: in vitro E.coli expression system
Expression System: 1-360aa
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MDPEETSVYLDYYYATSPNSDIRETHSHVPYTSVFLPVFYTAVFLTGVLGNLVLMGALHFKPGSRRLIDIFIINLAASDFIFLVTLPLWVDKEASLGLWRTGSFLCKGSSYMISVNMHCSVLLLTCMSVDRYLAIVWPVVSRKFRRTDCAYVVCASIWFISCLLGLPTLLSRELTLIDDKPYCAEKKATPIKLIWSLVALIFTFFVPLLSIVTCYCCIARKLCAHYQQSGKHNKKLKKSIKIIFIVVAAFLVSW