Recombinant Human G-protein coupled receptor 182 (GPR182)

Produktübersicht

• Artikelname: Recombinant Human G-protein coupled receptor 182 (GPR182)
• Artikelnummer: CSB-CF009791HU
• Hersteller Artikelnummer: CSB-CF009791HU
• Alternativnummer: CSB-CF009791HU-100, CSB-CF009791HU-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide

Produkteigenschaften

• Molekulargewicht: 46.8 kDa
• Tag: N-terminal 10xHis-tagged
• UniProt: O15218
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: in vitro E.coli expression system
• Expression System: 1-404aa
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MSVKPSWGPGPSEGVTAVPTSDLGEIHNWTELLDLFNHTLSECHVELSQSTKRVVLFALYLAMFVVGLVENLLVICVNWRGSGRAGLMNLYILNMAIADLGIVLSLPVWMLEVTLDYTWLWGSFSCRFTHYFYFVNMYSSIFFLVCLSVDRYVTLTSASPSWQRYQHRVRRAMCAGIWVLSAIIPLPEVVHIQLVEGPEPMCLFMAPFETYSTWALAVALSTTILGFLLPFPLITVFNVLTACRLRQPGQPKSR

Anwendungsbeschreibung

• Anwendungsbeschreibung: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration