Recombinant Human Glycophorin-B (GYPB)
Artikelnummer:
CSB-CF010075HU
- Bilder (0)
| Artikelname: | Recombinant Human Glycophorin-B (GYPB) |
| Artikelnummer: | CSB-CF010075HU |
| Hersteller Artikelnummer: | CSB-CF010075HU |
| Alternativnummer: | CSB-CF010075HU-100, CSB-CF010075HU-20 |
| Hersteller: | Cusabio |
| Kategorie: | Proteine/Peptide |
| Alternative Synonym: | PAS-3 SS-active sialoglycoprotein Sialoglycoprotein delta CD_antigen: CD235b,CSB-PR2024 |
| Molekulargewicht: | 10.5 kDa |
| Tag: | N-terminal 10xHis-tagged |
| UniProt: | P06028 |
| Puffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Quelle: | in vitro E.coli expression system |
| Expression System: | 20-91aa |
| Reinheit: | Greater than 85% as determined by SDS-PAGE. |
| Formulierung: | Liquid or Lyophilized powder |
| Sequenz: | LSTTEVAMHTSTSSSVTKSYISSQTNGETGQLVHRFTVPAPVVIILIILCVMAGIIGTILLISYSIRRLIKA |
Produktgarantie und fachkundiger Support
