Recombinant Human 5-hydroxytryptamine receptor 1B (HTR1B)

Produktübersicht

• Artikelname: Recombinant Human 5-hydroxytryptamine receptor 1B (HTR1B)
• Artikelnummer: CSB-CF010882HUB2
• Hersteller Artikelnummer: CSB-CF010882HUb2
• Alternativnummer: CSB-CF010882HUB2-100, CSB-CF010882HUB2-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: S12 Serotonin 1D beta receptor,CSB-PR2024

Produkteigenschaften

• Molekulargewicht: 62.1 kDa
• Tag: N-terminal 10xHis-SUMO-tagged
• UniProt: P28222
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: in vitro E.coli expression system
• Expression System: 1-390aa
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MEEPGAQCAPPPPAGSETWVPQANLSSAPSQNCSAKDYIYQDSISLPWKVLLVMLLALITLATTLSNAFVIATVYRTRKLHTPANYLIASLAVTDLLVSILVMPISTMYTVTGRWTLGQVVCDFWLSSDITCCTASILHLCVIALDRYWAITDAVEYSAKRTPKRAAVMIALVWVFSISISLPPFFWRQAKAEEEVSECVVNTDHILYTVYSTVGAFYFPTLLLIALYGRIYVEARSRILKQTPNRTGKRLTRA