Recombinant Human ATP-sensitive inward rectifier potassium channel 10 (KCNJ10)

Produktübersicht

• Artikelname: Recombinant Human ATP-sensitive inward rectifier potassium channel 10 (KCNJ10)
• Artikelnummer: CSB-CF012048HUB0
• Hersteller Artikelnummer: CSB-CF012048HUb0
• Alternativnummer: CSB-CF012048HUB0-100, CSB-CF012048HUB0-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: ATP-dependent inwardly rectifying potassium channel Kir4.1 Inward rectifier K(+) channel Kir1.2 Potassium channel, inwardly rectifying subfamily J member 10,CSB-PR2024

Produkteigenschaften

• Molekulargewicht: 48.6 kDa
• Tag: N-terminal 10xHis-tagged
• UniProt: P78508
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: in vitro E.coli expression system
• Expression System: 1-379aa
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MTSVAKVYYSQTTQTESRPLMGPGIRRRRVLTKDGRSNVRMEHIADKRFLYLKDLWTTFIDMQWRYKLLLFSATFAGTWFLFGVVWYLVAVAHGDLLELDPPANHTPCVVQVHTLTGAFLFSLESQTTIGYGFRYISEECPLAIVLLIAQLVLTTILEIFITGTFLAKIARPKKRAETIRFSQHAVVASHNGKPCLMIRVANMRKSLLIGCQVTGKLLQTHQTKEGENIRLNQVNVTFQVDTASDSPFLILPLT