Recombinant Rat ATP-sensitive inward rectifier potassium channel 10 (Kcnj10)

Artikelnummer: CSB-CF012048RA
Artikelname: Recombinant Rat ATP-sensitive inward rectifier potassium channel 10 (Kcnj10)
Artikelnummer: CSB-CF012048RA
Hersteller Artikelnummer: CSB-CF012048RA
Alternativnummer: CSB-CF012048RA-100, CSB-CF012048RA-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Alternative Synonym: (ATP-sensitive inward rectifier potassium channel KAB-2)(BIR10)(Brain-specific inwardly rectifying K(+) channel 1)(BIRK1)(Inward rectifier K(+) channel Kir4.1)(Potassium channel, inwardly rectifying subfamily J member 10),CSB-PR2024
Molekulargewicht: 48.5 kDa
Tag: N-terminal 10xHis-tagged
UniProt: P49655
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: in vitro E.coli expression system
Expression System: 1-379aa
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MTSVAKVYYSQTTQTESRPLVAPGIRRRRVLTKDGRSNVRMEHIADKRFLYLKDLWTTFIDMQWRYKLLLFSATFAGTWFLFGVVWYLVAVAHGDLLELGPPANHTPCVVQVHTLTGAFLFSLESQTTIGYGFRYISEECPLAIVLLIAQLVLTTILEIFITGTFLAKIARPKKRAETIRFSQHAVVAYHNGKLCLMIRVANMRKSLLIGCQVTGKLLQTHQTKEGENIRLNQVNVTFQVDTASDSPFLILPLT