Recombinant Rat Inward rectifier potassium channel 16 (Kcnj16)

Produktübersicht

• Artikelname: Recombinant Rat Inward rectifier potassium channel 16 (Kcnj16)
• Artikelnummer: CSB-CF012054RA
• Hersteller Artikelnummer: CSB-CF012054RA
• Alternativnummer: CSB-CF012054RA-100, CSB-CF012054RA-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: (BIR9)(Inward rectifier K(+) channel Kir5.1)(Potassium channel, inwardly rectifying subfamily J member 16),CSB-PR2024

Produkteigenschaften

• Molekulargewicht: 54.0 kDa
• Tag: N-terminal 10xHis-tagged
• UniProt: P52191
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: in vitro E.coli expression system
• Expression System: 1-419aa
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MSYYGSSYRIVNVDSKYPGYPPEHAIAEKRRARRRLLHKDGSCNVYFKHIFGEWGSYMVDIFTTLVDTKWRHMFVVFSLSYILSWLIFGSIFWLIALHHGDLLSDPDITPCVDNVHSFTAAFLFSLETQTTIGYGYRCVTEECSVAVLTVILQSILSCIINTFIIGAALAKMATARKRAQTIRFSYFALIGMRDGKLCLMWRIGDFRPNHVVEGTVRAQLLRYSEDSEGRMTMAFKDLKLVNDQIILVTPVTIV