Recombinant Human G protein-activated inward rectifier potassium channel 1 (KCNJ3)(F137S)
Artikelnummer:
CSB-CF012056HU(M)
- Bilder (0)
| Artikelname: | Recombinant Human G protein-activated inward rectifier potassium channel 1 (KCNJ3)(F137S) |
| Artikelnummer: | CSB-CF012056HU(M) |
| Hersteller Artikelnummer: | CSB-CF012056HU(M) |
| Alternativnummer: | CSB-CF012056HU(M)-100, CSB-CF012056HU(M)-20 |
| Hersteller: | Cusabio |
| Kategorie: | Proteine/Peptide |
| Alternative Synonym: | GIRK-1,Inward rectifier K(+,Potassium channel, inwardly rectifying subfamily J member 3 |
| Molekulargewicht: | 62.6 kDa |
| Tag: | N-terminal 10xHis-tagged |
| UniProt: | P48549 |
| Puffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Quelle: | in vitro E.coli expression system |
| Expression System: | 1-501aa(F137S) |
| Reinheit: | Greater than 85% as determined by SDS-PAGE. |
| Formulierung: | Liquid or Lyophilized powder |
| Sequenz: | MSALRRKFGDDYQVVTTSSSGSGLQPQGPGQDPQQQLVPKKKRQRFVDKNGRCNVQHGNLGSETSRYLSDLFTTLVDLKWRWNLFIFILTYTVAWLFMASMWWVIAYTRGDLNKAHVGNYTPCVANVYNFPSAFLFSIETEATIGYGYRYITDKCPEGIILFLFQSILGSIVDAFLIGCMFIKMSQPKKRAETLMFSEHAVISMRDGKLTLMFRVGNLRNSHMVSAQIRCKLLKSRQTPEGEFLPLDQLELDVG |
Produktgarantie und fachkundiger Support
