Recombinant Human Intermediate conductance calcium-activated potassium channel protein 4 (KCNN4)
Artikelnummer:
CSB-CF012086HU
- Bilder (0)
| Artikelname: | Recombinant Human Intermediate conductance calcium-activated potassium channel protein 4 (KCNN4) |
| Artikelnummer: | CSB-CF012086HU |
| Hersteller Artikelnummer: | CSB-CF012086HU |
| Alternativnummer: | CSB-CF012086HU-100, CSB-CF012086HU-20 |
| Hersteller: | Cusabio |
| Kategorie: | Proteine/Peptide |
| Alternative Synonym: | IKCa1 (IK1) (KCa3.1) (KCa4) (Putative Gardos channel) (IK1) (IKCA1) (KCA4) (SK4) (SK4) (SKCa 4) (SKCa4) |
| Molekulargewicht: | 53.7 kDa |
| Tag: | N-terminal 10xHis-tagged |
| UniProt: | O15554 |
| Puffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Quelle: | in vitro E.coli expression system |
| Expression System: | 1-427aa |
| Reinheit: | Greater than 85% as determined by SDS-PAGE. |
| Formulierung: | Liquid or Lyophilized powder |
| Sequenz: | MGGDLVLGLGALRRRKRLLEQEKSLAGWALVLAGTGIGLMVLHAEMLWFGGCSWALYLFLVKCTISISTFLLLCLIVAFHAKEVQLFMTDNGLRDWRVALTGRQAAQIVLELVVCGLHPAPVRGPPCVQDLGAPLTSPQPWPGFLGQGEALLSLAMLLRLYLVPRAVLLRSGVLLNASYRSIGALNQVRFRHWFVAKLYMNTHPGRLLLGLTLGLWLTTAWVLSVAERQAVNATGHLSDTLWLIPITFLTIGYG |
Produktgarantie und fachkundiger Support
