Recombinant Mouse Phospholipase D3 (Pld3)

Produktübersicht

• Artikelname: Recombinant Mouse Phospholipase D3 (Pld3)
• Artikelnummer: CSB-CF018146MO
• Hersteller Artikelnummer: CSB-CF018146MO
• Alternativnummer: CSB-CF018146MO-100, CSB-CF018146MO-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: Choline phosphatase 3 (Phosphatidylcholine-hydrolyzing phospholipase D3) (Schwannoma-associated protein 9) (SAM-9) (Sam9) (PLD 3),CSB-PR2024

Produkteigenschaften

• Molekulargewicht: 58.2 kDa
• Tag: N-terminal 10xHis-tagged
• UniProt: O35405
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: in vitro E.coli expression system
• Expression System: 1-488aa
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MKPKLMYQELKVPVEEPAGELPLNEIEAWKAAEKKARWVLLVLILAVVGFGALMTQLFLWEYGDLHLFGPNQRPAPCYDPCEAVLVESIPEGLEFPNATTSNPSTSQAWLGLLAGAHSSLDIASFYWTLTNNDTHTQEPSAQQGEEVLQQLQALAPRGVKVRIAVSKPNGPLADLQSLLQSGAQVRMVDMQKLTHGVLHTKFWVVDQTHFYLGSANMDWRSLTQVKELGVVMYNCSCLARDLTKIFEAYWFLGQ