Recombinant Mouse Serine/threonine-protein kinase PLK2 (Plk2)

Produktübersicht

• Artikelname: Recombinant Mouse Serine/threonine-protein kinase PLK2 (Plk2)
• Artikelnummer: CSB-CF018194MO
• Hersteller Artikelnummer: CSB-CF018194MO
• Alternativnummer: CSB-CF018194MO-100, CSB-CF018194MO-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: Polo-like kinase 2 Serine/threonine-protein kinase SNK Serum-inducible kinase,CSB-PR2024

Produkteigenschaften

• Molekulargewicht: 85.3 kDa
• Tag: N-terminal 10xHis-tagged and C-terminal Myc-tagged
• UniProt: P53351
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: in vitro E.coli expression system
• Expression System: 1-682aa
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MELLRTITYQPAAGTKMCEQALGKACGGDSKKKRPQQPSEDGQPQAQVTPAAPHHHHHHSHSGPEISRIIVDPTTGKRYCRGKVLGKGGFAKCYEMTDLTNNKVYAAKIIPHSRVAKPHQREKIDKEIELHRLLHHKHVVQFYHYFEDKENIYILLEYCSRRSMAHILKARKVLTEPEVRYYLRQIVSGLKYLHEQEILHRDLKLGNFFINEAMELKVGDFGLAARLEPLEHRRRTICGTPNYLSPEVLNKQGH