Recombinant Human Bone marrow proteoglycan (PRG2), partial

Produktübersicht

• Artikelname: Recombinant Human Bone marrow proteoglycan (PRG2), partial
• Artikelnummer: CSB-CF018670HUA2
• Hersteller Artikelnummer: CSB-CF018670HUa2
• Alternativnummer: CSB-CF018670HUA2-100, CSB-CF018670HUA2-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: Proteoglycan 2 Cleaved into the following chain: Eosinophil granule major basic protein Short name: EMBP Short name: MBP Alternative name(s): Pregnancy-associated major basic protein,CSB-PR2024

Produkteigenschaften

• Molekulargewicht: 29.8 kDa
• Tag: N-terminal 6xHis-SUMO-tagged
• UniProt: P13727
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: in vitro E.coli expression system
• Expression System: 106-222aa
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: TCRYLLVRSLQTFSQAWFTCRRCYRGNLVSIHNFNINYRIQCSVSALNQGQVWIGGRITGSGRCRRFQWVDGSRWNFAYWAAHQPWSRGGHCVALCTRGGHWRRAHCLRRLPFICSY