Recombinant Human Pulmonary surfactant-associated protein B (SFTPB)

Produktübersicht

• Artikelname: Recombinant Human Pulmonary surfactant-associated protein B (SFTPB)
• Artikelnummer: CSB-CF021173HU
• Hersteller Artikelnummer: CSB-CF021173HU
• Alternativnummer: CSB-CF021173HU-100, CSB-CF021173HU-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: 18KDA pulmonary-surfactant protein 6KDA protein Pulmonary surfactant-associated proteolipid SPL(Phe)

Produkteigenschaften

• Molekulargewicht: 24.7 kDa
• Tag: N-terminal 6xHis-SUMO-tagged
• UniProt: P07988
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: in vitro E.coli expression system
• Expression System: 201-279aa
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: FPIPLPYCWLCRALIKRIQAMIPKGALAVAVAQVCRVVPLVAGGICQCLAERYSVILLDTLLGRMLPQLVCRLVLRCSM