Recombinant Human Transmembrane protein 158 (TMEM158)

Produktübersicht

• Artikelname: Recombinant Human Transmembrane protein 158 (TMEM158)
• Artikelnummer: CSB-CF023732HU
• Hersteller Artikelnummer: CSB-CF023732HU
• Alternativnummer: CSB-CF023732HU-100, CSB-CF023732HU-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: (40 kDa BINP-binding protein)(p40BBP)(Ras-induced senescence protein 1),CSB-PR2024

Produkteigenschaften

• Molekulargewicht: 29.9 kDa
• Tag: N-terminal 10xHis-tagged
• UniProt: Q8WZ71
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: in vitro E.coli expression system
• Expression System: 21-300aa
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: GAADAPGLLGVPSNASVNASSADEPIAPRLLASAAPGPPERPGPEEAAAAAAPCNISVQRQMLSSLLVRWGRPRGFQCDLLLFSTNAHGRAFFAAAFHRVGPPLLIEHLGLAAGGAQQDLRLCVGCGWVRGRRTGRLRPAAAPSAAAATAGAPTALPAYPAAEPPGPLWLQGEPLHFCCLDFSLEELQGEPGWRLNRKPIESTLVACFMTLVIVVWSVAALIWPVPIIAGFLPNGMEQRRTTASTTAATPAAVP