Recombinant Human Transmembrane protein 59 (TMEM59)

Produktübersicht

• Artikelname: Recombinant Human Transmembrane protein 59 (TMEM59)
• Artikelnummer: CSB-CF023860HU
• Hersteller Artikelnummer: CSB-CF023860HU
• Alternativnummer: CSB-CF023860HU-100, CSB-CF023860HU-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: Liver membrane-bound protein

Produkteigenschaften

• Molekulargewicht: 35.5 kDa
• Tag: C-terminal 10xHis-tagged
• UniProt: Q9BXS4
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: in vitro E.coli expression system
• Expression System: 37-323aa
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: AFDSVLGDTASCHRACQLTYPLHTYPKEEELYACQRGCRLFSICQFVDDGIDLNRTKLECESACTEAYSQSDEQYACHLGCQNQLPFAELRQEQLMSLMPKMHLLFPLTLVRSFWSDMMDSAQSFITSSWTFYLQADDGKIVIFQSKPEIQYAPHLEQEPTNLRESSLSKMSYLQMRNSQAHRNFLEDGESDGFLRCLSLNSGWILTTTLVLSVMVLLWICCATVATAVEQYVPSEKLSIYGDLEFMNEQKLNR