Recombinant Rat Thyrotropin receptor (Tshr)

Artikelnummer: CSB-CF025131RA
Artikelname: Recombinant Rat Thyrotropin receptor (Tshr)
Artikelnummer: CSB-CF025131RA
Hersteller Artikelnummer: CSB-CF025131RA
Alternativnummer: CSB-CF025131RA-100, CSB-CF025131RA-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Alternative Synonym: Thyroid-stimulating hormone receptor,TSH-R
Molekulargewicht: 85.7 kDa
Tag: N-terminal 10xHis-tagged
UniProt: P21463
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: in vitro E.coli expression system
Expression System: 22-764aa
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: RGCTSPPCECHQEDDFRVTCKELHQIPSLPPSTQTLKLIETHLKTIPSLAFSSLPNISRIYLSIDATLQRLEPHSFYNLSKMTHIEIRNTRSLTYIDPDALTELPLLKFLGIFNTGLRIFPDLTKIYSTDVFFILEITDNPYMTSVPENAFQGLCNETLTLKLYNNGFTSIQGHAFNGTKLDAVYLNKNKYLTAIDKDAFGGVYSGPTLLDVSSTSVTALPSKGLEHLKELIAKNTWTLKKLPLSLSFLHLTRA
Anwendungsbeschreibung: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration