Recombinant Human Nucleolar transcription factor 1 (UBTF)
Artikelnummer:
CSB-CF025524HUB2
- Bilder (0)
| Artikelname: | Recombinant Human Nucleolar transcription factor 1 (UBTF) |
| Artikelnummer: | CSB-CF025524HUB2 |
| Hersteller Artikelnummer: | CSB-CF025524HUb2 |
| Alternativnummer: | CSB-CF025524HUB2-100, CSB-CF025524HUB2-20 |
| Hersteller: | Cusabio |
| Kategorie: | Proteine/Peptide |
| Alternative Synonym: | Autoantigen NOR-90 Upstream-binding factor 1,CSB-PR2024 |
| Molekulargewicht: | 107.9 kDa |
| Tag: | N-terminal 10xHis-SUMO-tagged |
| UniProt: | P17480 |
| Puffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Quelle: | in vitro E.coli expression system |
| Expression System: | 1-764aa |
| Reinheit: | Greater than 90% as determined by SDS-PAGE. |
| Formulierung: | Liquid or Lyophilized powder |
| Sequenz: | MNGEADCPTDLEMAAPKGQDRWSQEDMLTLLECMKNNLPSNDSSKFKTTESHMDWEKVAFKDFSGDMCKLKWVEISNEVRKFRTLTELILDAQEHVKNPYKGKKLKKHPDFPKKPLTPYFRFFMEKRAKYAKLHPEMSNLDLTKILSKKYKELPEKKKMKYIQDFQREKQEFERNLARFREDHPDLIQNAKKSDIPEKPKTPQQLWYTHEKKVYLKVRPDATTKEVKDSLGKQWSQLSDKKRLKWIHKALEQRK |
Produktgarantie und fachkundiger Support
