Recombinant Human UDP-glucuronosyltransferase 2B17 (UGT2B17)

Produktübersicht

• Artikelname: Recombinant Human UDP-glucuronosyltransferase 2B17 (UGT2B17)
• Artikelnummer: CSB-CF025590HU
• Hersteller Artikelnummer: CSB-CF025590HU
• Alternativnummer: CSB-CF025590HU-100, CSB-CF025590HU-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: (UDPGT 2B17)(UGT2B17)(C19-steroid-specific UDP-glucuronosyltransferase)(C19-steroid-specific UDPGT),CSB-PR2024

Produkteigenschaften

• Molekulargewicht: 64.5 kDa
• Tag: N-terminal 10xHis-tagged
• UniProt: O75795
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: in vitro E.coli expression system
• Expression System: 24-530aa
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: GKVLVWPTEYSHWINMKTILEELVQRGHEVIVLTSSASILVNASKSSAIKLEVYPTSLTKNDLEDFFMKMFDRWTYSISKNTFWSYFSQLQELCWEYSDYNIKLCEDAVLNKKLMRKLQESKFDVLLADAVNPCGELLAELLNIPFLYSLRFSVGYTVEKNGGGFLFPPSYVPVVMSELSDQMIFMERIKNMIYMLYFDFWFQAYDLKKWDQFYSEVLGRPTTLFETMGKAEMWLIRTYWDFEFPRPFLPNVDF