Recombinant Human Apolipoprotein A-I (APOA1), partial
Artikelnummer:
CSB-CF2066
- Bilder (0)
| Artikelname: | Recombinant Human Apolipoprotein A-I (APOA1), partial |
| Artikelnummer: | CSB-CF2066 |
| Hersteller Artikelnummer: | CSB-CF2066 |
| Alternativnummer: | CSB-CF2066-100, CSB-CF2066-20 |
| Hersteller: | Cusabio |
| Kategorie: | Proteine/Peptide |
| Alternative Synonym: | Apo-AI,ApoA-I,Apolipoprotein A1,ProapoA-I,Apolipoprotein A-I1-242 |
| Molekulargewicht: | 25.0 kDa |
| Tag: | N-terminal 6xHis-tagged |
| UniProt: | P02647 |
| Puffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Quelle: | in vitro E.coli expression system |
| Expression System: | 79-267aa |
| Reinheit: | Greater than 85% as determined by SDS-PAGE. |
| Formulierung: | Liquid or Lyophilized powder |
| Sequenz: | STFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQ |
Produktgarantie und fachkundiger Support
