Recombinant Plasmodium berghei Major facilitator superfamily domain-containing protein,partial

Produktübersicht

• Artikelname: Recombinant Plasmodium berghei Major facilitator superfamily domain-containing protein,partial
• Artikelnummer: CSB-CF2221PLHA2
• Hersteller Artikelnummer: CSB-CF2221PLHa2
• Alternativnummer: CSB-CF2221PLHA2-100, CSB-CF2221PLHA2-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: /

Produkteigenschaften

• Molekulargewicht: 39.9 kDa
• Tag: N-terminal 6xHis-SUMO-tagged
• UniProt: A0A0Y9WQZ1
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: in vitro E.coli expression system
• Expression System: 756-960aa
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: QNIKTIFSSFTFYFFFFIFIYAFLLSIMHIFINYFFYIYLFVFNINIYISNIYTIIMTFASLIAIPFSGYIIDNIGSFLFLLLCSSFFILIAISGTIYSCVFNLRSEVIAFISFNLIGISESIIPTVIISQIPTHLCVKKNEDITAAFAIFELVSMLIVSVNNYIFGYFLINKEYLNGLYILFVFVILVISLIFLLIFTIYWKAR