Recombinant Staphylococcus aureus Enterotoxin type I (SEI)

Produktübersicht

• Artikelname: Recombinant Staphylococcus aureus Enterotoxin type I (SEI)
• Artikelnummer: CSB-CF2248FKZ
• Hersteller Artikelnummer: CSB-CF2248FKZ
• Alternativnummer: CSB-CF2248FKZ-100, CSB-CF2248FKZ-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: sei

Produkteigenschaften

• Molekulargewicht: 47.9 kDa
• Tag: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
• UniProt: O85383
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: in vitro E.coli expression system
• Expression System: 1-242aa
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MKKFKYSFILVFILLFNIKDLTYAQGDIGVGNLRNFYTKHDYIDLKGVTDKNLPIANQLEFSTGTNDLISESNNWDEISKFKGKKLDIFGIDYNGPCKSKYMYGGATLSGQYLNSARKIPINLWVNGKHKTISTDKIATNKKLVTAQEIDVKLRRYLQEEYNIYGHNNTGKGKEYGYKSKFYSGFNNGKVLFHLNNEKSFSYDLFYTGDGLPVSFLKIYEDNKIIESEKFHLDVEISYVDSN