Recombinant Macaca fascicularis C-C chemokine receptor type 8 (CCR8)

Artikelnummer: CSB-CF2709MOV
Artikelname: Recombinant Macaca fascicularis C-C chemokine receptor type 8 (CCR8)
Artikelnummer: CSB-CF2709MOV
Hersteller Artikelnummer: CSB-CF2709MOV
Alternativnummer: CSB-CF2709MOV-100, CSB-CF2709MOV-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Alternative Synonym: ,CSB-PR2024
Molekulargewicht: 54.0 kDa
Tag: N-terminal 6xHis-SUMO-tagged
UniProt: G7NYJ2
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: in vitro E.coli expression system
Expression System: 1-355aa
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MDYTLDPSMTTMTDYYYPDSLSSPCDGELIQRNDKLLLAVFYCLLFVFSLLGNSLVILVLVVCKKLRNITDIYLLNLALSDLLFVFSFPFQTYYQLDQWVFGTVMCKVVSGFYYIGFYSSMFFITLMSVDRYLAVVHAVYAIKVRTIRMGTTLSLVVWLTAIMATIPLLVFYQVASEDGVLQCYSFYNQQTLKWKIFTNFEMNILGLLIPFTIFMFCYIKILHQLKRCQNHNKTKAIRLVLIVVIASLLFWVPF