Recombinant Human G protein-coupled receptor 20 variant

Produktübersicht

• Artikelname: Recombinant Human G protein-coupled receptor 20 variant
• Artikelnummer: CSB-CF3008HU
• Hersteller Artikelnummer: CSB-CF3008HU
• Alternativnummer: CSB-CF3008HU-100, CSB-CF3008HU-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: /,CSB-PR2024

Produkteigenschaften

• Molekulargewicht: 35.8 kDa
• Tag: N-terminal 10xHis-tagged
• UniProt: Q59GP3
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: in vitro E.coli expression system
• Expression System: 1-273aa
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: TPSVIYTINLVVTDLLVGLSLPTRFAVYYGARGCLRCAFPHVLGYFLNMHCSILFLTCICVDRYLAIVRPEGSRRCRQPACARAVCAFVWLAAGAVTLSVLGVTGSRPCCRVFALTVLEFLLPLLVISVFTGRIMCALSRPGLLHQGRQRRVRAMQLLLTVLIIFLVCFTPFHARQVAVALWPDMPHHTSLVVYHVAVTLSSLNSCMDPIVYCFVTSGFQATVRGLFGQHGEREPSSGDVVSMHRSSKGSGRHH