Recombinant Mycoplasma pneumoniae P30 adhesin (p30)

Produktübersicht

• Artikelname: Recombinant Mycoplasma pneumoniae P30 adhesin (p30)
• Artikelnummer: CSB-CF301931MLW
• Hersteller Artikelnummer: CSB-CF301931MLW
• Alternativnummer: CSB-CF301931MLW-100, CSB-CF301931MLW-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: 30 kDa adhesin-related protein (Cytadhesin P30),CSB-PR2024

Produkteigenschaften

• Molekulargewicht: 32.6 kDa
• Tag: N-terminal 10xHis-tagged
• UniProt: P75330
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: in vitro E.coli expression system
• Expression System: 1-274aa
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MKLPPRRKLKLFLLAWMLVLFSALIVLATLILVQHNNTELTEVKSELSPLNVVLHAEEDTVQIQGKPITEQAWFIPTVAGCFGFSALAIILGLAIGLPIVKRKEKRLLEEKERQEQLAEQLQRISAQQEEQQALEQQAAAEAHAEAEVEPAPQPVPVPPQPQVQINFGPRTGFPPQPGMAPRPGMPPHPGMAPRPGFPPQPGMAPRPGMPPHPGMAPRPGFPPQPGMAPRPGMPPHPGMAPRPGFPPQPGMAPR