Recombinant Human herpesvirus 2 Envelope glycoprotein E (gE)

Produktübersicht

• Artikelname: Recombinant Human herpesvirus 2 Envelope glycoprotein E (gE)
• Artikelnummer: CSB-CF310072HJX
• Hersteller Artikelnummer: CSB-CF310072HJX
• Alternativnummer: CSB-CF310072HJX-100, CSB-CF310072HJX-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: gE,gE-2

Produkteigenschaften

• Molekulargewicht: 60.1 kDa
• Tag: N-terminal 10xHis-tagged
• UniProt: P89475
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: in vitro E.coli expression system
• Expression System: 21-545aa
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: AAPRTSWKRVTSGEDVVLLPAPAERTRAHKLLWAAEPLDACGPLRPSWVALWPPRRVLETVVDAACMRAPEPLAIAYSPPFPAGDEGLYSELAWRDRVAVVNESLVIYGALETDSGLYTLSVVGLSDEARQVASVVLVVEPAPVPTPTPDDYDEEDDAGVTNARRSAFPPQPPPRRPPVAPPTHPRVIPEVSHVRGVTVHMETLEAILFAPGETFGTNVSIHAIAHDDGPYAMDVVWMRFDVPSSCADMRIYEA