Recombinant Barmah forest virus Structural polyprotein, partial

Produktübersicht

• Artikelname: Recombinant Barmah forest virus Structural polyprotein, partial
• Artikelnummer: CSB-CF311258BEU
• Hersteller Artikelnummer: CSB-CF311258BEU
• Alternativnummer: CSB-CF311258BEU-100, CSB-CF311258BEU-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: p130,CSB-PR2024

Produkteigenschaften

• Molekulargewicht: 50.7 kDa
• Tag: N-terminal 10xHis-tagged
• UniProt: P89946
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: in vitro E.coli expression system
• Expression System: 801-1239aa
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: YEHSTTMPNQVGIPFKALIERPGYAGLPLSLVVIKSELVPSLVQDYITCNYKTVVPSPYIKCCGGAECSHKNEADYKCSVFTGVYPFMWGGAYCFCDTENSQMSEVYVTRGESCEADHAIAYQVHTASLKAQVMISIGELNQTVDVFVNGDSPARIQQSKFILGPISSAWSPFDHKVIVYRDEVYNEDYAPYGSGQAGRFGDIQSRTVNSTDVYANTNLKLKRPASGNVHVPYTQTPSGFSYWKKEKGVPLNRN