Recombinant Porcine reproductive and respiratory syndrome virus Envelope small membrane protein (GP2b)

Produktübersicht

• Artikelname: Recombinant Porcine reproductive and respiratory syndrome virus Envelope small membrane protein (GP2b)
• Artikelnummer: CSB-CF314480PQC
• Hersteller Artikelnummer: CSB-CF314480PQC
• Alternativnummer: CSB-CF314480PQC-100, CSB-CF314480PQC-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: (Protein E)(Glycoprotein 2b)(Protein GP2b)(Gs),CSB-PR2024

Produkteigenschaften

• Molekulargewicht: 13.7 kDa
• Tag: N-terminal 10xHis-tagged
• UniProt: P0C6Y6
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: in vitro E.coli expression system
• Expression System: 2-70aa
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: GSLWSKISQLFVDAFTEFLVSVVDIAIFLAILFGFTVAGWLLVFLLRVVCSALLRSRSAIHSPELSKVL-