Recombinant Rice Amino acid permease (AAP6)

Artikelnummer: CSB-CF3147OCO
Artikelname: Recombinant Rice Amino acid permease (AAP6)
Artikelnummer: CSB-CF3147OCO
Hersteller Artikelnummer: CSB-CF3147OCO
Alternativnummer: CSB-CF3147OCO-100, CSB-CF3147OCO-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Alternative Synonym: ,CSB-PR2024
Molekulargewicht: 52.9 kDa
Tag: N-terminal 10xHis-tagged
UniProt: A0A088MWT3
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: in vitro E.coli expression system
Expression System: 1-466aa
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MDVEKVERKEVAVDDDGRVRTGTVWTATTHAITAVIGSGVLALPWSVAQMGWVLGPIALVVCAYITYYTAVLLCDCYRTPDPVHGKRNYTYMDVVRSCLGPRDVVVCGIAQYAILWGAMVGYTITTATSIMSVVRTNCHHYKGPDATCGSSGTMYMVLFGLAEVVLSQCPSLEGVTLISVVAAVMSFTYSFVGLFLSAAKVASHGAAHGTLLGVRVGAGGVTASTKAWHFLQALGNIAFAYTYSMLLIEIQDTV