Recombinant Avian infectious bronchitis virus Spike glycoprotein (S), partial

Produktübersicht

• Artikelname: Recombinant Avian infectious bronchitis virus Spike glycoprotein (S), partial
• Artikelnummer: CSB-CF321003ARV
• Hersteller Artikelnummer: CSB-CF321003ARV
• Alternativnummer: CSB-CF321003ARV-100, CSB-CF321003ARV-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: (S glycoprotein)(E2)(Peplomer protein),CSB-PR2024

Produkteigenschaften

• Molekulargewicht: 26.8 kDa
• Tag: C-terminal 6xHis-tagged
• UniProt: P12650
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: in vitro E.coli expression system
• Expression System: 317-537aa
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: ESNFMYGSYHPSCSFRLETINNGLWFNSLSVSIAYGPLQGGCKQSVFSGRATCCYAYSYGGPLLCKGVYSGELDHNFECGLLVYVTKSGGSRIQTATEPPVITQHNYNNITLNTCVDYNIYGRIGQGFITNVTDSAVSYNYLADAGLAILDTSGSIDIFVVQSEYGLNYYKVNPCEDVNQQFVVSGGKLVGILTSRNETGSQLLENQFYIKITNGTRRFRR