Recombinant Gossypium hirsutum Cellulose synthase (LOC107958683) (S143G)

Produktübersicht

• Artikelname: Recombinant Gossypium hirsutum Cellulose synthase (LOC107958683) (S143G)
• Artikelnummer: CSB-CF3218GHB(M)
• Hersteller Artikelnummer: CSB-CF3218GHB(M)
• Alternativnummer: CSB-CF3218GHB(M)-100, CSB-CF3218GHB(M)-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide

Produkteigenschaften

• Molekulargewicht: 119.8 kDa
• Tag: C-terminal 6xHis-tagged
• UniProt: A0A1U8PFM0
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: in vitro E.coli expression system
• Expression System: 1-1039aa(S143G)
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MEASAGLVAGSHNRNELVVIHGHEEPKPLKNLDGQVCEICGDEIGLTVDGDLFVACNECGFPVCRPCYEYERREGSQQCPQCKTRYKRLKGSPRVEGDEDEEDVDDIEHEFNIDDEQNKYRNIAESMLHGKMSYGRGPEDDEGLQIPPGLSGVQSRPVSGEFPIGSSLAYGEHMSNKRVHPYPMSEPGSARWDEKKEGGWRERMDDWKMQQGNLGPEPDDAYDADMAMLDEARQPLSRKVPIASSKINPYRMVI